PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009603097.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 314aa    MW: 37207.6 Da    PI: 7.0539
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009603097.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.32.7e-48181432128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     ppG+rF P+deel+ +yLkk+v +++l+  + ikev++yk+ P++L  +    +ekewyfF++rd+ky++g+r+nra+ +gyWkatg dk++++ 
  XP_009603097.1  18 PPGYRFCPQDEELIIHYLKKRVMNERLPH-DKIKEVNLYKYSPQQLSeNYSMLGEKEWYFFTPRDRKYPNGNRPNRAAGKGYWKATGADKPIKH- 110
                     9**************************99.88**************8444445899**************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +vg +k Lvfy+g+ pkg kt+W+mhe+r+
  XP_009603097.1 111 NDVKVGFRKALVFYEGKPPKGDKTNWIMHEFRV 143
                     999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-588169IPR003441NAC domain
PROSITE profilePS5100555.0317169IPR003441NAC domain
PfamPF023652.1E-2518143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MISEISRVNY VDDSFVFPPG YRFCPQDEEL IIHYLKKRVM NERLPHDKIK EVNLYKYSPQ  60
QLSENYSMLG EKEWYFFTPR DRKYPNGNRP NRAAGKGYWK ATGADKPIKH NDVKVGFRKA  120
LVFYEGKPPK GDKTNWIMHE FRVNESRRLK RHAQDMRLDD WVLCRIYKKV DKSFKNARKE  180
HEQDDTSISC SSIGKVENCD YEGITDSYEI ARQNLKLPHH YDITFDDPGF NMDYNKYSID  240
NFSHFGPRSN YGIPLQPSFS PGNIFWDQKG YQENCNILPM HFDVNNFYQD SYDEIQSQNI  300
LDSVLDENSS IYKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-581716915168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487930.10.0PREDICTED: NAC transcription factor 29-like
SwissprotA0SPJ41e-63NAMB1_TRIDC; NAC transcription factor NAM-B1
TrEMBLK4D3D21e-98K4D3D2_SOLLC; Uncharacterized protein
STRINGSolyc10g083450.1.13e-98(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-64NAC-like, activated by AP3/PI